ExactAntigen

FANCG Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002189-M01
Product Type:Primary Antibody
Product Name:FANCG Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2189
Host:Mouse
Clone:2C8
Isotype:IgG2a kappa
Product Description:Mouse Monoclonal anti-FANCG (2C8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = FANCG PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.FANCG, involved in
Alternate Names:anti-FAG antibody, anti-XRCC9 antibody
Immunogen:FANCG (AAH11623, 1 a.a. ~ 623 a.a) full length recombinant protein with GST tag.
Epitope:MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGLPAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGLRELWDSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSC ...
Specificity:FANCG - Fanconi anemia, complementation group G
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Product References:D. Stejskal, M. Karpisek. Adipocyte fatty acid binding protein in a Caucasian population: a new marker of metabolic syndrome? Eur J Clin Invest. 2006 Sep;36(9):621-5.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:FANCG
Omim ID:602956
see all human FANCG antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about