ExactAntigen

Mouse Monoclonal anti-FANCC (6E7)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00002176-M01
ProductName:FANCC Antibody
Product Description:Mouse Monoclonal anti-FANCC (6E7)
Clone:6E7
Clonality:Monoclonal
Immunogen:FANCC (NP_000127, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTVIERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINK* ...
Specificity:FANCC - Fanconi anemia, complementation group C
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group C.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-FA3 antibody, anti-FAC antibody, anti-FACC antibody, anti-FLJ14675 antibody
ProteinTarget:FANCC - Fanconi anemia, complementation group C
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:2176
Gene_Symbol:FANCC
Omim_ID:227645,
see all human FANCC antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about