| Catalog Code: | H00002176-A01 |
| Product Type: | Primary Antibody |
| Product Name: | FANCC Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 2176 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-FANCC |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene delays the onset of apoptosis and promotes homologous recombination repair of damaged DNA. Mutations in this gene result in Fanconi anemia. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery |
| Alternate Names: | anti-FA3 antibody, anti-FAC antibody, anti-FACC antibody, anti-FLJ14675 antibody |
| Immunogen: | FANCC (NP_000127, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTVIERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINK* ... |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant FANCC. |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | FANCC |
| Omim ID: | 227645, |