| Catalog Code: | H00002173-B01 |
| Product Type: | Primary Antibody |
| Product Name: | FABP7 Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 2173 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-FABP7 - fatty acid binding protein 7, brain, MaxPab Antibody |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to |
| Alternate Names: | anti-B-FABP antibody, anti-BLBP antibody, anti-DKFZp547J2313 antibody, anti-FABPB antibody, anti-MRG antibody |
| Immunogen: | FABP7 (AAH12299, 1 a.a. ~ 133 a.a) full-length human protein. |
| Epitope: | MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA* ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against transfected protein with on ELISA and Western Blot. Untransfected protein used as a negative control. |
| Application Summary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |