ExactAntigen

FABP7 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002173-B01
Product Type:Primary Antibody
Product Name:FABP7 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:2173
Host:Mouse
Product Description:Mouse Polyclonal anti-FABP7 - fatty acid binding protein 7, brain, MaxPab Antibody
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to
Alternate Names:anti-B-FABP antibody, anti-BLBP antibody, anti-DKFZp547J2313 antibody, anti-FABPB antibody, anti-MRG antibody
Immunogen:FABP7 (AAH12299, 1 a.a. ~ 133 a.a) full-length human protein.
Epitope:MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA* ...
Preservative:No Preservative
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against transfected protein with on ELISA and Western Blot. Untransfected protein used as a negative control.
Application Summary:WB, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
see all human FABP7 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about