| CatalogCode: | H00002172-B01 |
| ProductName: | FABP6 Antibody |
| Product Description: | Mouse Polyclonal anti-FABP6 - fatty acid binding protein 6, ileal (gastrotropin), MaxPab Antibody |
| Clonality: | Polyclonal |
| Immunogen: | FABP6 (AAH22489, 1 a.a. ~ 129 a.a) full-length human protein. |
| Epitope: | MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against transfected protein with on ELISA and Western Blot. Untransfected protein used as a negative control. |
| Control: | H00002172-T01 |
| Background: | This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-I-15P antibody, anti-I-BABP antibody, anti-I-BALB antibody, anti-I-BAP antibody, anti-ILBP antibody, anti-ILBP3 antibody, anti-ILLBP antibody |
| ProteinTarget: | fatty acid binding protein 6, ileal (gastrotropin) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 2172 |
| Gene_Symbol: | FABP6 |