ExactAntigen

Mouse Polyclonal anti-FABP5 - fatty acid binding protein 5 (psoriasis-associated), MaxPab Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00002171-B02
ProductName:FABP5 Antibody
Product Description:Mouse Polyclonal anti-FABP5 - fatty acid binding protein 5 (psoriasis-associated), MaxPab Antibody
Clonality:Polyclonal
Immunogen:FABP5 (NP_001435, 1 a.a. ~ 135 a.a) full-length human protein.
Epitope:MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE ...
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:295
AppSummary:WB, ELISA
SpeciesSummary:Hu
ALTnames:anti-E-FABP antibody, anti-EFABP antibody, anti-PA-FABP antibody, anti-PAFABP antibody
ProteinTarget:fatty acid binding protein 5 (psoriasis-associated)
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id:2171
Gene_Symbol:FABP5
see all human FABP5 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about