ExactAntigen

FABP3 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002170-M01
Product Type:Primary Antibody
Product Name:FABP3 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2170
Host:Mouse
Clone:4F6-1D6
Isotype:IgG2a kappa
Product Description:Mouse Monoclonal anti-FABP3 (4F6-1D6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = FABP3 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The intracellular f
Alternate Names:anti-FABP11 antibody, anti-H-FABP antibody, anti-MDGI antibody, anti-O-FABP antibody
Immunogen:FABP3 (AAH07021, 1 a.a. ~ 134 a.a) full length recombinant protein with GST tag.
Epitope:MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA* ...
Specificity:FABP3 - fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:FABP3
Omim ID:134651
see all human FABP3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about