| CatalogCode: | H00002170-B01 |
| ProductType: | Primary Antibody |
| ProductName: | FABP3 Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 2170 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-FABP3 - fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor), MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in th |
| ALTnames: | anti-FABP11 antibody, anti-H-FABP antibody, anti-MDGI antibody, anti-O-FABP antibody |
| Immunogen: | FABP3 (NP_004093, 1 a.a. ~ 133 a.a) full-length human protein. |
| Epitope: | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |