ExactAntigen

FABP1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002168-M02
Product Type:Primary Antibody
Product Name:FABP1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2168
Host:Mouse
Clone:5F7
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-FABP1 (5F7)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = FABP1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.FABP1 encodes the f
Alternate Names:anti-FABPL antibody, anti-L-FABP antibody
Immunogen:FABP1 (AAH32801, 1 a.a. ~ 128 a.a) full length recombinant protein with GST tag.
Epitope:MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI* ...
Specificity:FABP1 - fatty acid binding protein 1, liver
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:FABP1
Omim ID:134650,
see all human FABP1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about