ExactAntigen

F9 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002158-M01
Product Type:Primary Antibody
Product Name:F9 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2158
Host:Mouse
Clone:2C9
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-F9 (2C9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = F9 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes vita
Alternate Names:anti-FIX antibody, anti-GLA domain antibody, anti-HEMB antibody, anti-MGC129641 antibody, anti-MGC129642 antibody, anti-PTC antibody
Immunogen:F9 (NP_000124, 96 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Epitope:QCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLT* ...
Specificity:F9 - coagulation factor IX (plasma thromboplastic component, Christmas disease, hemophilia B)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:F9
Omim ID:306900,
see all human F9 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about