| Catalog Code: | H00002155-A01 |
| Product Type: | Primary Antibody |
| Product Name: | F7 Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 2155 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-F7 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes coagulation factor VII which is a vitamin K-dependent factor essential for hemostasis. This factor circulates in the blood in a zymogen form, and is converted to an active form by either factor IXa, factor Xa, factor XIIa, or thrombin by |
| Immunogen: | F7 (NP_000122, 103 a.a. ~ 213 a.a) partial recombinant protein with GST tag. |
| Epitope: | SYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGR* ... |
| Specificity: | F7 - coagulation factor VII (serum prothrombin conversion accelerator) |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. No preservative. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | F7 |
| Omim ID: | 227500 |