| CatalogCode: | H00002149-B02 |
| ProductType: | Primary Antibody |
| ProductName: | F2R Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 2149 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-F2R - coagulation factor II (thrombin) receptor, MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. |
| ALTnames: | anti-CF2R antibody, anti-HTR antibody, anti-PAR1 antibody, anti-TR antibody |
| Immunogen: | F2R (AAH02464, 1 a.a. ~ 425 a.a) full-length human protein. |
| Epitope: | MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLNITTCH ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |