| CatalogCode: | H00002065-M03 |
| ProductName: | v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 Antibody |
| Product Description: | Mouse Monoclonal anti-v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (2A4) |
| Clone: | 2A4 |
| Clonality: | Monoclonal |
| Immunogen: | ERBB3 (AAH02706, 21 a.a. ~ 332 a.a) full length recombinant protein with GST tag. |
| Epitope: | EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPN ... |
| Specificity: | v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ErbB-3 antibody, anti-HER3 antibody, anti-MDA-BF-1 antibody, anti-MGC88033 antibody, anti-c-erbB-3 antibody, anti-c-erbB3 antibody, anti-erbB3-S antibody, anti-p180-ErbB3 antibody, anti-p45-sErbB3 antibody, anti-p85-sErbB3 antibody |
| ProteinTarget: | v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 2065 |
| Gene_Symbol: | ERBB3 |
| Omim_ID: | 190151, |
order or
more information: | company product webpage |
| request information: |
|