ExactAntigen

ERBB3 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002065-M02
Product Type:Primary Antibody
Product Name:ERBB3 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2065
Host:Mouse
Clone:3F12
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-ERBB3 (3F12)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 7-10. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes a member of the epidermal growth factor rec
Alternate Names:anti-ErbB-3 antibody, anti-HER3 antibody, anti-MDA-BF-1 antibody, anti-MGC88033 antibody, anti-c-erbB-3 antibody, anti-c-erbB3 antibody, anti-erbB3-S antibody, anti-p180-ErbB3 antibody, anti-p45-sErbB3 antibody, anti-p85-sErbB3 antibody
Immunogen:ERBB3 (AAH02706, 21 a.a. ~ 332 a.a) full length recombinant protein with GST tag.
Epitope:EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPN ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:100 ug purified IgG
Package Size:100 ug
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ERBB3
Omim ID:190151,
see all human ERBB3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about