| CatalogCode: | | H00002042-M02 |
| ProductName: | | EPHA3 Antibody |
| Product Description: | | Mouse Monoclonal anti-EPHA3 (3E9) |
| Clone: | | 3E9 |
| Clonality: | | Monoclonal |
| Immunogen: | | EPHA3 (AAH63282, 202 a.a. ~ 326 a.a) partial recombinant protein with GST tag. |
| Epitope: | | CPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPP ... |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | | This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG Mix Kappa |
| Host_Name: | | Mouse |
| Buffer: | | In 1x PBS, pH 7.2 |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-ETK antibody, anti-ETK1 antibody, anti-HEK antibody, anti-HEK4 antibody, anti-TYRO4 antibody |
| ProteinTarget: | | EPHA3 |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 2042 |
| Gene_Symbol: | | EPHA3 |
| Omim_ID: | | 179611, |
| more information: | | company product webpage |