ExactAntigen

MARK2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002011-M01
Product Type:Primary Antibody
Product Name:MARK2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2011
Host:Mouse
Clone:3B12
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-MARK2 (3B12)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = MARK2 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.EMK (ELKL Motif Kin
Alternate Names:anti-EMK1 antibody, anti-MGC99619 antibody, anti-PAR-1 antibody
Immunogen:MARK2 (AAH08771, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
Epitope:QAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPG ...
Specificity:MARK2 - MAP/microtubule affinity-regulating kinase 2
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:MARK2
Omim ID:600526
see all human MARK2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about