ExactAntigen

EGR1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00001958-M08
Product Type:Primary Antibody
Product Name:EGR1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:1958
Host:Mouse
Clone:1F5
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-EGR1 (1F5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis
Alternate Names:anti-AT225 antibody, anti-G0S30 antibody, anti-KROX-24 antibody, anti-NGFI-A antibody, anti-TIS8 antibody, anti-ZIF-268 antibody, anti-ZNF225 antibody
Immunogen:EGR1 (NP_001955, 211 a.a. ~ 320 a.a) full length recombinant protein with GST tag.
Epitope:TPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSR* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is
Gene Symbol:EGR1
Omim ID:128990,
see all human EGR1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about