ExactAntigen

Mouse Monoclonal anti-EGR1 (3G3)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00001958-M07
ProductName:EGR1 Antibody
Product Description:Mouse Monoclonal anti-EGR1 (3G3)
Clone:3G3
Clonality:Monoclonal
Immunogen:EGR1 (NP_001955, 444 a.a. ~ 544 a.a) partial recombinant protein with GST tag.
Epitope:SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC* ...
Specificity:EGR1 - early growth response 1
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-AT225 antibody, anti-G0S30 antibody, anti-KROX-24 antibody, anti-NGFI-A antibody, anti-TIS8 antibody, anti-ZIF-268 antibody, anti-ZNF225 antibody
ProteinTarget:EGR1 - early growth response 1
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:1958
Gene_Symbol:EGR1
Omim_ID:128990,
see all human EGR1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about