ExactAntigen

EGR1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00001958-M01
Product Type:Primary Antibody
Product Name:EGR1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:1958
Host:Mouse
Clone:2B5
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-EGR1 (2B5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = EGR1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded
Alternate Names:anti-AT225 antibody, anti-G0S30 antibody, anti-KROX-24 antibody, anti-NGFI-A antibody, anti-TIS8 antibody, anti-ZIF-268 antibody, anti-ZNF225 antibody
Immunogen:EGR1 (NP_001955, 444 a.a. ~ 544 a.a) partial recombinant protein with GST tag.
Epitope:SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC* ...
Specificity:EGR1 - early growth response 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:EGR1
Omim ID:128990,
see all human EGR1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about