ExactAntigen

EFNA1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00001942-M01
Product Type:Primary Antibody
Product Name:EFNA1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:1942
Host:Mouse
Clone:3C6
Isotype:IgG Mix Kappa
Product Description:Mouse Monoclonal anti-EFNA1 (3C6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = EFNA1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes a
Alternate Names:anti-B61 antibody, anti-ECKLG antibody, anti-EFL1 antibody, anti-EPLG1 antibody, anti-LERK1 antibody, anti-TNFAIP4 antibody
Immunogen:EFNA1 (AAH32698, 21 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
Epitope:HTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYIS* ...
Specificity:EFNA1 - ephrin-A1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:EFNA1
Omim ID:191164
see all human EFNA1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about