ExactAntigen

EEF1A1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00001915-A01
Product Type:Primary Antibody
Product Name:EEF1A1 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:1915
Host:Mouse
Product Description:Mouse Polyclonal anti-EEF1A1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = 1915 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-EEF-1 antibody, anti-EEF1A antibody, anti-EF-Tu antibody, anti-EF1A antibody, anti-GRAF-1EF antibody, anti-HNGC:16303 antibody, anti-LENG7 antibody, anti-MGC16224 antibody, anti-PTI1 antibody, anti-eEF1A-1 antibody
Immunogen:EEF1A1 (AAH09875, 156 a.a. ~ 256 a.a) partial recombinant protein with GST tag.
Epitope:DSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYK* ...
Specificity:EEF1A1 - eukaryotic translation elongation factor 1 alpha 1
Purity:Whole antisera
Packaging:50 ul Whole antisera Mouse antisera.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:EEF1A1
Omim ID:130590,
see all human EEF1A1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about