| CatalogCode: | H00001820-B01 |
| ProductName: | ARID3A Antibody |
| Product Description: | Mouse Polyclonal anti-ARID3A - AT rich interactive domain 3A (BRIGHT- like), MaxPab Antibody |
| Clonality: | Polyclonal |
| Immunogen: | ARID3A (-, 1 a.a. ~ 593 a.a) full-length human protein. |
| Epitope: | MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPHGRARAAPDEDREPESARMQRAQMAALAAMRAAAAGLGHPASPGGSEDGPPGSEEEDAAREGTPGSPGRGREGPGEEHFEDMASDEDMKPKWEEEEMEEDLGEDEEEEEEDYEDEEEEEDEEGLGPPGPASLGTTALFPRKAQPPQAFRGDGVPRVLGGQERPGPGPAHPGGAAHVAPQLQPPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKR ... |
| CrossReactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-BRIGHT antibody, anti-DRIL1 antibody, anti-DRIL3 antibody, anti-E2FBP1 antibody |
| ProteinTarget: | AT rich interactive domain 3A (BRIGHT- like) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 1820 |
| Gene_Symbol: | ARID3A |
order or
more information: | company product webpage |
| request information: |
|