| CatalogCode: | H00001803-A01 |
| ProductName: | DPP4 Antibody |
| Product Description: | Mouse Polyclonal anti-DPP4 |
| Clonality: | Polyclonal |
| Immunogen: | DPP4 (AAH65265, 352 a.a. ~ 452 a.a) partial recombinant protein with GST tag. |
| Epitope: | GWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSCELNP* ... |
| Specificity: | DPP4 - dipeptidylpeptidase 4 (CD26, adenosine deaminase complexing protein 2) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml Whole antisera Mouse antisera. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ADABP antibody, anti-ADCP2 antibody, anti-CD26 antibody, anti-DPPIV antibody, anti-TP103 antibody |
| ProteinTarget: | DPP4 - dipeptidylpeptidase 4 (CD26, adenosine deaminase complexing protein 2) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 1803 |
| Gene_Symbol: | DPP4 |
| Omim_ID: | 102720 H00001803-M03 |