ExactAntigen

Mouse Monoclonal anti-DNTT (4H5)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00001791-M01
ProductName:DNTT Antibody
Product Description:Mouse Monoclonal anti-DNTT (4H5)
Clone:4H5
Clonality:Monoclonal
Immunogen:DNTT (AAH12920, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Epitope:MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIEC ...
Specificity:DNTT - deoxynucleotidyltransferase, terminal
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-TDT antibody
ProteinTarget:DNTT - deoxynucleotidyltransferase, terminal
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:1791
Gene_Symbol:DNTT
Omim_ID:187410 H00008448-A01
see all human DNTT antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about