ExactAntigen

Mouse Monoclonal anti-TIMM8A (2F11) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00001678-M01
ProductName: TIMM8A Antibody
Product Description: Mouse Monoclonal anti-TIMM8A (2F11)
Clone: 2F11
Clonality: Monoclonal
Immunogen: TIMM8A (NP_004076, 9 a.a. ~ 98 a.a) partial recombinant protein with GST tag.
Epitope: AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD* ...
Specificity: TIMM8A - translocase of inner mitochondrial membrane 8 homolog A (yeast)
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background: This translocase has similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Deafness Dystonia Syndrome (MTS/DFN-1) and it is postulated that MTS/DFN-1 is a mitochondrial disease caused by a defective mitochondrial protein import system.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB, IHC-P
SpeciesSummary: Hu
ALTnames: anti-DDP antibody, anti-DDP1 antibody, anti-DFN1 antibody, anti-MGC12262 antibody, anti-MTS antibody
ProteinTarget: TIMM8A - translocase of inner mitochondrial membrane 8 homolog A (yeast)
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 1678
Gene_Symbol: TIMM8A
Omim_ID: 300,356,304,700,311,000 H00001678-B01
more information: company product webpage
Also see:
see all human TIMM8A antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about