| CatalogCode: | H00001678-B01 |
| ProductType: | Primary Antibody |
| ProductName: | TIMM8A Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 1678 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-TIMM8A - translocase of inner mitochondrial membrane 8 homolog A (yeast), MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | This translocase has similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Deafness Dystonia Syndrome (MTS/DFN-1) and it is po |
| ALTnames: | anti-DDP antibody, anti-DDP1 antibody, anti-DFN1 antibody, anti-MGC12262 antibody, anti-MTS antibody |
| Immunogen: | TIMM8A (NP_004076, 1 a.a. ~ 97 a.a) full-length human protein. |
| Epitope: | MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |