| CatalogCode: | H00001673-M01 |
| ProductName: | DEFB4 Antibody |
| Product Description: | Mouse Monoclonal anti-DEFB4 (4C4) |
| Clone: | 4C4 |
| Clonality: | Monoclonal |
| Immunogen: | DEFB4 (NP_004933, 24 a.a. ~ 65 a.a) partial recombinant protein with GST tag. |
| Epitope: | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DEFB-2 antibody, anti-DEFB102 antibody, anti-DEFB2 antibody, anti-HBD-2 antibody, anti-SAP1 antibody |
| ProteinTarget: | defensin, beta 4 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 1673 |
| Gene_Symbol: | DEFB4 |
| Omim_ID: | 602215, |