| CatalogCode: | | H00001656-M01 |
| ProductName: | | DDX6 Antibody |
| Product Description: | | Mouse Monoclonal anti-DDX6 (3D2) |
| Clone: | | 3D2 |
| Clonality: | | Monoclonal |
| Immunogen: | | DDX6 (AAH65007, 1 a.a. ~ 484 a.a) full length recombinant protein with GST tag. |
| Epitope: | | MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQD ... |
| Specificity: | | DDX6 - DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections. |
| Background: | | This gene encodes a member of the DEAD box protein family. The protein is an RNA helicase found in P-bodies and stress granules, and functions in translation suppression and mRNA degradation. It is required for microRNA-induced gene silencing. |
| ProductRef: | | 1. Broytman O, Westmark PR, Gurel Z, Malter JS. Rck/p54 interacts with APP mRNA as part of a multi-protein complex and enhances APP mRNA and protein expression in neuronal cell lines. Neurobiol Aging. 2008 Mar 28 |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG1 kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB, IHC-P |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-HLR2 antibody, anti-P54 antibody, anti-RCK antibody |
| ProteinTarget: | | DDX6 - DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 1656 |
| Gene_Symbol: | | DDX6 |
| Omim_ID: | | 600326 NB200-191 |
| more information: | | company product webpage |