| CatalogCode: | H00001649-A01 |
| ProductName: | DDIT3 Antibody |
| Product Description: | Mouse Polyclonal anti-DDIT3 |
| Clonality: | Polyclonal |
| Immunogen: | DDIT3 (AAH03637, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSL ... |
| Specificity: | DDIT3 - DNA-damage-inducible transcript 3 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| ProductRef: | Su Hyung Hong, Byoung-Mog Kwon et al. Apoptosis induction of 2'-hydroxycinnamaldehyde as a proteasome inhibitor is associated with ER stress and mitochondrial perturbation in cancer cells. Biochemical Pharmacology, Available online 24 May 2007 |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CEBPZ antibody, anti-CHOP antibody, anti-CHOP10 antibody, anti-GADD153 antibody, anti-MGC4154 antibody |
| ProteinTarget: | DDIT3 - DNA-damage-inducible transcript 3 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 1649 |
| Gene_Symbol: | DDIT3 |
| Omim_ID: | 126337 H00001649-M01 |