ExactAntigen

DCN Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00001634-M01
Product Type:Primary Antibody
Product Name:DCN Antibody
List Price:275
Clonality:Monoclonal
Gene ID:1634
Host:Mouse
Clone:3H4-1F4
Isotype:IgG2b kappa
Product Description:Mouse Monoclonal anti-DCN (3H4-1F4)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = DCN PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded b
Alternate Names:anti-DSPG2 antibody, anti-PG40 antibody, anti-PGII antibody, anti-PGS2 antibody, anti-SLRR1B antibody
Immunogen:DCN (AAH05322, 1 a.a. ~ 360 a.a) full length recombinant protein with GST tag.
Epitope:MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFN ...
Specificity:DCN - decorin
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections.
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:DCN
Omim ID:125255,
see all human decorin antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about