| Catalog Code: | H00001633-A01 |
| Product Type: | Primary Antibody |
| Product Name: | DCK Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 1633 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-DCK |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycy |
| Immunogen: | DCK (NP_000779, 161 a.a. ~ 261 a.a) partial recombinant protein with GST tag. |
| Epitope: | WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL* ... |
| Specificity: | DCK - deoxycytidine kinase |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. No preservative. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Product References: | Giovannetti E, Danesi R et al.. Transcription analysis of human equilibrative nucleoside transporter-1 predicts survival in pancreas cancer patients treated with gemcitabine. Cancer Res. 2006 Apr 1;66(7):3928-35. |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | DCK |
| Omim ID: | 125450 |