ExactAntigen

DCK Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00001633-A01
Product Type:Primary Antibody
Product Name:DCK Antibody
List Price:205
Clonality:Polyclonal
Gene ID:1633
Host:Mouse
Product Description:Mouse Polyclonal anti-DCK
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycy
Immunogen:DCK (NP_000779, 161 a.a. ~ 261 a.a) partial recombinant protein with GST tag.
Epitope:WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL* ...
Specificity:DCK - deoxycytidine kinase
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera
Application Summary:ELISA, WB
Product References:Giovannetti E, Danesi R et al.. Transcription analysis of human equilibrative nucleoside transporter-1 predicts survival in pancreas cancer patients treated with gemcitabine. Cancer Res. 2006 Apr 1;66(7):3928-35.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:DCK
Omim ID:125450
see all human deoxycytidine kinase antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about