ExactAntigen

Mouse Polyclonal anti-DARS
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00001615-A02
ProductName:DARS Antibody
Product Description:Mouse Polyclonal anti-DARS
Clonality:Polyclonal
Immunogen:DARS (AAH00629, 1 a.a. ~ 502 a.a) full length recombinant protein with GST tag.
Epitope:MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQ ...
Specificity:DARS - aspartyl-tRNA synthetase
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera
Background:Aspartyl-tRNA synthetase (DARS) is part of a multienzyme complex of aminoacyl-tRNA synthetases. Aspartyl-tRNA synthetase charges its cognate tRNA with aspartate during protein biosynthesis.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-DKFZp781B11202 antibody
ProteinTarget:DARS - aspartyl-tRNA synthetase
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:1615
Gene_Symbol:DARS
Omim_ID:603084 H00001615-A01
see all human DARS antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about