| CatalogCode: | | H00001612-M01 |
| ProductName: | | DAPK1 Antibody |
| Product Description: | | Mouse Monoclonal anti-DAPK1 (2E7) |
| Clone: | | 2E7 |
| Clonality: | | Monoclonal |
| Immunogen: | | DAPK1 (NP_004929, 1211 a.a. ~ 1310 a.a) partial recombinant protein with GST tag. |
| Epitope: | | LLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLT ... |
| Specificity: | | DAPK1 - death-associated protein kinase 1 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody reactive against recombinant protein on ELISA. |
| Background: | | Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consensus sites. It is a tumor suppressor candidate. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG1 kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-DAPK antibody, anti-DKFZp781I035 antibody |
| ProteinTarget: | | DAPK1 - death-associated protein kinase 1 |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 1612 |
| Gene_Symbol: | | DAPK1 |
| Omim_ID: | | 600831 NB110-56926 |
| more information: | | company product webpage |