ExactAntigen

Mouse Monoclonal anti-DAPK1 (2E7) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00001612-M01
ProductName: DAPK1 Antibody
Product Description: Mouse Monoclonal anti-DAPK1 (2E7)
Clone: 2E7
Clonality: Monoclonal
Immunogen: DAPK1 (NP_004929, 1211 a.a. ~ 1310 a.a) partial recombinant protein with GST tag.
Epitope: LLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLT ...
Specificity: DAPK1 - death-associated protein kinase 1
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody reactive against recombinant protein on ELISA.
Background: Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consensus sites. It is a tumor suppressor candidate.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA
SpeciesSummary: Hu
ALTnames: anti-DAPK antibody, anti-DKFZp781I035 antibody
ProteinTarget: DAPK1 - death-associated protein kinase 1
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 1612
Gene_Symbol: DAPK1
Omim_ID: 600831 NB110-56926
more information: company product webpage
Also see:
see all human DAPK1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about