| CatalogCode: | H00001591-M07 |
| ProductName: | CYP24A1 Antibody |
| Product Description: | Mouse Monoclonal anti-CYP24A1 (1F8) |
| Clone: | 1F8 |
| Clonality: | Monoclonal |
| Immunogen: | CYP24A1 (NP_000773, 415 a.a. ~ 515 a.a) partial recombinant protein with GST tag. |
| Epitope: | LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR* ... |
| Specificity: | CYP24A1 - cytochrome P450, family 24, subfamily A, polypeptide 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CP24 antibody, anti-CYP24 antibody, anti-MGC126273 antibody, anti-MGC126274 antibody, anti-P450-CC24 antibody |
| ProteinTarget: | CYP24A1 - cytochrome P450, family 24, subfamily A, polypeptide 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 1591 |
| Gene_Symbol: | CYP24A1 |
| Omim_ID: | 126065, |
order or
more information: | company product webpage |
| request information: |
|