ExactAntigen

Mouse Polyclonal anti-CYP24A1 | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00001591-A01
ProductName: CYP24A1 Antibody
Product Description: Mouse Polyclonal anti-CYP24A1
Clonality: Polyclonal
Immunogen: CYP24A1 (NP_000773, 415 a.a. ~ 515 a.a) partial recombinant protein with GST tag.
Epitope: LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR* ...
Specificity: CYP24A1 - cytochrome P450, family 24, subfamily A, polypeptide 1
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml Whole antisera Mouse antisera.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein.
Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-CP24 antibody, anti-CYP24 antibody, anti-P450-CC24 antibody
ProteinTarget: CYP24A1 - cytochrome P450, family 24, subfamily A, polypeptide 1
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 1591
Gene_Symbol: CYP24A1
Omim_ID: 126065,
more information: company product webpage
Also see:
see all human CYP24A1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about