| CatalogCode: | H00001540-M03 |
| ProductName: | CYLD Antibody |
| Product Description: | Mouse Monoclonal anti-CYLD (2G1) |
| Clone: | 2G1 |
| Clonality: | Monoclonal |
| Immunogen: | CYLD (AAH12342, 854 a.a. ~ 953 a.a) partial recombinant protein with GST tag. |
| Epitope: | QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CDMT antibody, anti-CYLD1 antibody, anti-EAC antibody, anti-HSPC057 antibody, anti-KIAA0849 antibody, anti-USPL2 antibody |
| ProteinTarget: | cylindromatosis (turban tumor syndrome) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 1540 |
| Gene_Symbol: | CYLD |
| Omim_ID: | 132700, 605018, |
order or
more information: | company product webpage |
| request information: |
|