ExactAntigen

Mouse Polyclonal anti-CTLA4 | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00001493-A01
ProductName: CTLA4 Antibody
Product Description: Mouse Polyclonal anti-CTLA4
Clonality: Polyclonal
Immunogen: CTLA4 (NP_005205, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Epitope: KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY* ...
Specificity: CTLA4 - cytotoxic T-lymphocyte-associated protein 4
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background: This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-CD152 antibody, anti-CTLA-4 antibody
ProteinTarget: CTLA4 - cytotoxic T-lymphocyte-associated protein 4
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 1493
Gene_Symbol: CTLA4
Omim_ID: 123890 140300 275000
more information: company product webpage
Also see:
see all human CTLA 4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about