ExactAntigen

Mouse Monoclonal anti-CSTB (M2-F1) | Novus Biologicals antibody product information
CatalogCode:H00001476-M02
ProductName:CSTB Antibody
Product Description:Mouse Monoclonal anti-CSTB (M2-F1)
Clone:M2-F1
Clonality:Monoclonal
Immunogen:CSTB (AAH03370, 1 a.a. ~ 297 a.a) full length recombinant protein with GST tag.
Epitope:MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF ...
Specificity:CSTB - cystatin B (stefin B)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background:The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1).
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB, IHC-P
SpeciesSummary:Hu
ALTnames:anti-CST6 antibody, anti-EPM1 antibody, anti-PME antibody, anti-STFB antibody, anti-cystatin B antibody
ProteinTarget:CSTB - cystatin B (stefin B)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:1476
Gene_Symbol:CSTB
Omim_ID:254800,D649 601145
order or
more information
:
company product webpage
request information:
Also see:
all human CSTB antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about