| CatalogCode: | H00001432-M01 |
| ProductName: | mitogen-activated protein kinase 14 Antibody |
| Product Description: | Mouse Monoclonal anti-mitogen-activated protein kinase 14 (3D5) |
| Clone: | 3D5 |
| Clonality: | Monoclonal |
| Immunogen: | MAPK14 (AAH31574, 260 a.a. ~ 360 a.a) partial recombinant protein with GST tag. |
| Epitope: | QSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ... |
| Specificity: | mitogen-activated protein kinase 14 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections. |
| Background: | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB, IHC-P |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CSBP1 antibody, anti-CSBP2 antibody, anti-CSPB1 antibody, anti-EXIP antibody, anti-Mxi2 antibody, anti-PRKM14 antibody, anti-PRKM15 antibody, anti-RK antibody, anti-SAPK2A antibody, anti-p38 antibody, anti-p38ALPHA antibody |
| ProteinTarget: | mitogen-activated protein kinase 14 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 1432 |
| Gene_Symbol: | MAPK14 |
| Omim_ID: | 600289, |
order or
more information: | company product webpage |
| request information: |
|