ExactAntigen

HAPLN1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00001404-B01
Product Type:Primary Antibody
Product Name:HAPLN1 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:1404
Host:Mouse
Product Description:Mouse Polyclonal anti-HAPLN1 - hyaluronan and proteoglycan link protein 1, MaxPab Antibody
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Alternate Names:anti-CRTL1 antibody
Immunogen:HAPLN1 (AAH57808, 1 a.a. ~ 355 a.a) full-length human protein.
Epitope:MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTS ...
Preservative:No Preservative
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
see all human HAPLN1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about