| CatalogCode: | | H00001307-A01 |
| ProductName: | | COL16A1 Antibody |
| Product Description: | | Mouse Polyclonal anti-COL16A1 |
| Clonality: | | Polyclonal |
| Immunogen: | | COL16A1 (NP_001847, 117 a.a. ~ 217 a.a) partial recombinant protein with GST tag. |
| Epitope: | | WYLFQVTDANGYPQISLEVNSQERSLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVASVHVDCSSASSQPLGPRRPMRPVGHVFLGLDAEQGK* ... |
| Specificity: | | COL16A1 - collagen, type XVI, alpha 1 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | This gene encodes the alpha chain of type XVI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. High levels of type XVI collagen have been found in fibroblasts and keratinocytes, and in smooth muscle and amnion. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-447AA antibody, anti-FP1572 antibody |
| ProteinTarget: | | COL16A1 - collagen, type XVI, alpha 1 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 1307 |
| Gene_Symbol: | | COL16A1 |
| Omim_ID: | | 120326 H00001310-A01 |
| more information: | | company product webpage |