| CatalogCode: | H00001244-M01 |
| ProductName: | ABCC2 Antibody |
| Product Description: | Mouse Monoclonal anti-ABCC2 (1C5) |
| Clone: | 1C5 |
| Clonality: | Monoclonal |
| Immunogen: | ABCC2 (NP_000383, 214 a.a. ~ 314 a.a) partial recombinant protein with GST tag. |
| Epitope: | LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA* ... |
| Specificity: | ABCC2 - ATP-binding cassette, sub-family C (CFTR/MRP), member 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ABC30 antibody, anti-CMOAT antibody, anti-DJS antibody, anti-KIAA1010 antibody, anti-MRP2 antibody, anti-cMRP antibody |
| ProteinTarget: | ABCC2 - ATP-binding cassette, sub-family C (CFTR/MRP), member 2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 1244 |
| Gene_Symbol: | ABCC2 |
| Omim_ID: | 237,500,601,107 H00010257-M03 |