ExactAntigen

Mouse Monoclonal anti-CLPS (8A8)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00001208-M01
ProductName:CLPS Antibody
Product Description:Mouse Monoclonal anti-CLPS (8A8)
Clone:8A8
Clonality:Monoclonal
Immunogen:CLPS (NP_001823, 23 a.a. ~ 113 a.a) partial recombinant protein with GST tag.
Epitope:GIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ* ...
Specificity:CLPS - colipase, pancreatic
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:The protein encoded by this gene is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overall hydrophobic binding site. The gene product allows lipase to anchor noncovalently to the surface of lipid micelles, counteracting the destabilizing influence of intestinal bile salts. This cofactor is only expressed in pancreatic acinar cells, suggesting regulation of expression by tissue-specific elements.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ProteinTarget:CLPS - colipase, pancreatic
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:1208
Gene_Symbol:CLPS
Omim_ID:120105,
see all human CLPS antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about