ExactAntigen

CKB Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00001152-M01
Product Type:Primary Antibody
Product Name:CKB Antibody
List Price:275
Clonality:Monoclonal
Gene ID:1152
Host:Mouse
Clone:3D5-3D11
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-CKB (3D5-3D11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = CKB PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded b
Alternate Names:anti-CKB antibody, anti-creatine kinase antibody, anti-brainantibody, anti-B-CK antibody, anti-CKBBantibody, anti-brain creatine kinase antibody, anti-creatine kinase B-chain antibody, anti-creatine kinase-B antibody
Immunogen:CKB (AAH01190, 1 a.a. ~ 382 a.a) full length recombinant protein with GST tag.
Epitope:MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCT ...
Specificity:CKB - creatine kinase, brain
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:CKB
Omim ID:123280,
see all human CKB antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about