| CatalogCode: | H00001152-A03 |
| ProductName: | CKB Antibody |
| Product Description: | Mouse Polyclonal anti-CKB |
| Clonality: | Polyclonal |
| Immunogen: | CKB (NP_001814, 281 a.a. ~ 382 a.a) partial recombinant protein with GST tag. |
| Epitope: | LTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK* ... |
| Specificity: | CKB - creatine kinase, brain |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CKB antibody, anti-creatine kinase antibody, anti-brainantibody, anti-B-CK antibody, anti-CKBBantibody, anti-brain creatine kinase antibody, anti-creatine kinase B-chain antibody, anti-creatine kinase-B antibody |
| ProteinTarget: | CKB - creatine kinase, brain |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 1152 |
| Gene_Symbol: | CKB |
| Omim_ID: | 123280, |