ExactAntigen

Mouse Polyclonal anti-CKB | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00001152-A01
ProductName: CKB Antibody
Product Description: Mouse Polyclonal anti-CKB
Clonality: Polyclonal
Immunogen: CKB (AAH01190, 1 a.a. ~ 382 a.a) full length recombinant protein with GST tag.
Epitope: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCT ...
Specificity: CKB - creatine kinase, brain
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background: The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-CKB antibody, anti-creatine kinase antibody, anti-brainantibody, anti-B-CK antibody, anti-CKBBantibody, anti-brain creatine kinase antibody, anti-creatine kinase B-chain antibody, anti-creatine kinase-B antibody
ProteinTarget: CKB - creatine kinase, brain
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 1152
Gene_Symbol: CKB
Omim_ID: 123280 H00001152-M01
more information: company product webpage
Also see:
see all human CKB antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about