ExactAntigen

Mouse Polyclonal anti-CHD3 | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00001107-A01
ProductName: CHD3 Antibody
Product Description: Mouse Polyclonal anti-CHD3
Clonality: Polyclonal
Immunogen: CHD3 (NP_001005273, 1654 a.a. ~ 1742 a.a) partial recombinant protein with GST tag.
Epitope: KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH* ...
Specificity: CHD3 - chromodomain helicase DNA binding protein 3
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background: This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-Mi-2a antibody, anti-Mi2-ALPHA antibody, anti-ZFH antibody
ProteinTarget: CHD3 - chromodomain helicase DNA binding protein 3
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 1107
Gene_Symbol: CHD3
Omim_ID: 602120 H00001107-M01
more information: company product webpage
Also see:
see all human CHD3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about