| CatalogCode: | | H00001081-A02 |
| ProductName: | | CGA Antibody |
| Product Description: | | Mouse Polyclonal anti-CGA |
| Clonality: | | Polyclonal |
| Immunogen: | | CGA (AAH10957, 25 a.a. ~ 117 a.a) partial recombinant protein with GST tag. |
| Epitope: | | APDVQDCPECTLQENPLFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS* ... |
| Specificity: | | CGA - glycoprotein hormones, alpha polypeptide |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CG-ALPHA antibody, anti-FSHA antibody, anti-GPHA1 antibody, anti-GPHa antibody, anti-HCG antibody, anti-LHA antibody, anti-TSHA antibody |
| ProteinTarget: | | CGA - glycoprotein hormones, alpha polypeptide |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 1081 |
| Gene_Symbol: | | CGA |
| Omim_ID: | | 118850 H00001081-A01 |
| more information: | | company product webpage |