| CatalogCode: | H00001069-M01 |
| ProductName: | CETN2 Antibody |
| Product Description: | Mouse Monoclonal anti-CETN2 (3F8) |
| Clone: | 3F8 |
| Clonality: | Monoclonal |
| Immunogen: | CETN2 (NP_004335, 85 a.a. ~ 173 a.a) partial recombinant protein with GST tag. |
| Epitope: | NFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY* ... |
| Specificity: | CETN2 - centrin, EF-hand protein, 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CALT antibody, anti-CEN2 antibody |
| ProteinTarget: | CETN2 - centrin, EF-hand protein, 2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 1069 |
| Gene_Symbol: | CETN2 |
| Omim_ID: | 300006 H00001070-M01 |
order or
more information: | company product webpage |
| request information: |
|