| CatalogCode: | H00001032-B01 |
| ProductName: | CDKN2D Antibody |
| Product Description: | Mouse Polyclonal anti-CDKN2D |
| Clonality: | Polyclonal |
| Immunogen: | CDKN2D (AAH01822, 1 a.a. ~ 167 a.a) full-length human protein. |
| Epitope: | MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL* ... |
| Specificity: | Mouse polyclonal antibody raised against a full-length human CDKN2D protein. |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on transfected lysate.Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-INK4D antibody, anti-p19 antibody, anti-p19-INK4D antibody |
| ProteinTarget: | CDKN2D |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 1032 |
| Gene_Symbol: | CDKN2D |
| Omim_ID: | 600927, |